PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100231350141
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 402aa    MW: 45439.8 Da    PI: 6.4349
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100231350141genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.71.1e-32282337156
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                   k+r++W+peLH+rFv+a++qLGG++ AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Ote100231350141|100231350141 282 KQRRCWSPELHRRFVNALQQLGGAQAATPKQIRELMQVDGLTNDEVKSHLQKYRLH 337
                                   79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.992279339IPR017930Myb domain
SuperFamilySSF466895.73E-18280340IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-29281340IPR009057Homeodomain-like
TIGRFAMsTIGR015573.9E-27282337IPR006447Myb domain, plants
PfamPF002499.1E-8284335IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
IFWFLKPPLL YFLSLNSRCS HXXXXXXXXX IADNHQDLAT EMGSLIPPEL ALDCNISSSM  60
PRDFLAEVSR MGSVSEKIPK LDDYVNRLEE EMKKIDAFKR ELPLCMLLLN DAIVTMKDEL  120
MRWKNANPEP ILEEFMPMKE SSQDEKIDDV RGTDIVNRNE KMNWMSSVQL WNSDSNKRTE  180
EAIDRPAIDE LFRSDKKRKV EKSFSPFKGC GNFPAMVIGK EDRDESAGAP SLSLRTPEIK  240
NSTDDTFRIG FTSKSSSSRS GSSCGTNSQS SFKAESQQIG RKQRRCWSPE LHRRFVNALQ  300
QLGGAQAATP KQIRELMQVD GLTNDEVKSH LQKYRLHTRR VPPTTKEQCG ESSKPSNSHS  360
SSPQGPLHLP GSSRGNSVTG GDSLEEEDDD EKSESHSWKS HI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011092742.11e-163PREDICTED: uncharacterized protein LOC105172852
TrEMBLA0A068TME11e-119A0A068TME1_COFCA; Uncharacterized protein
STRINGVIT_03s0063g01060.t011e-115(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43612443